PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00145.1.g00510.1.sm.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 317aa    MW: 34202.2 Da    PI: 9.6657
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00145.1.g00510.1.sm.mkgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP130.36.9e-4176152278
                                   -SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS
                           SBP   2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 
                                   C v++C+adls++++yhrrhkvCe+hsk+pvv+v g+e+rfCqqCsrfh+lsefDe+krsCr+rL++hn+rrrk+q 
  Zjn_sc00145.1.g00510.1.sm.mk  76 CSVDRCRADLSRCRDYHRRHKVCEAHSKTPVVVVGGQEKRFCQQCSRFHMLSEFDEGKRSCRKRLDGHNRRRRKPQR 152
                                   **************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.102.2E-3370137IPR004333Transcription factor, SBP-box
PROSITE profilePS5114131.92373150IPR004333Transcription factor, SBP-box
SuperFamilySSF1036127.72E-3975155IPR004333Transcription factor, SBP-box
PfamPF031107.1E-3076149IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 317 aa     Download sequence    Send to blast
MNRAAVTSEA SSWGAAADRG PTMLSFAGPS SSTSPAAEIQ FQDFSVGLVR RAQPPGSSGA  60
RRRSRGASGG GVPEACSVDR CRADLSRCRD YHRRHKVCEA HSKTPVVVVG GQEKRFCQQC  120
SRFHMLSEFD EGKRSCRKRL DGHNRRRRKP QRDVMNLGSF PYHQVNQFAI HPQLATRSGQ  180
HSNSMRLIDG QQAFSISFAG TCKAPKQFPF SQEGGSILNE FHPNNLLAEH DSHTRSSGLS  240
GMLGPEYALS LLSSSLHRPS PAAGPAQVTS PLACFVATSQ DATTAAAVGY ASGAAHHTFA  300
PDAVLEDPSQ ALPFIWQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A2e-2966149184squamosa promoter binding protein-like 4
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1132149KRSCRKRLDGHNRRRRKP
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002450775.11e-117hypothetical protein SORBIDRAFT_05g017510
SwissprotQ2R3Y12e-83SPL19_ORYSJ; Putative squamosa promoter-binding-like protein 19
TrEMBLC5Y2L51e-117C5Y2L5_SORBI; Putative uncharacterized protein Sb05g017510
STRINGSb05g017510.11e-117(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP129612532
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G50670.13e-39SBP family protein